PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.006G120400.6
Common NameB456_006G120400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 665aa    MW: 74517.5 Da    PI: 8.4344
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.006G120400.6genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.33.5e-24159260199
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++p++ ae++      ++++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +
  Gorai.006G120400.6 159 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYKQTRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVAGDAVLFL--R 247
                         99****************************8444556789************************************************..4 PP

                         SSEE..EEEEE-S CS
                  B3  87 rsefelvvkvfrk 99 
                          +++el+++++r+
  Gorai.006G120400.6 248 GEDGELRLGIRRA 260
                         49999*****996 PP

2Auxin_resp116.13.1e-38285366182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         +a+a+s+ks+F+v+Y+Pras++eFv++++k+ k++ ++v++G+Rfkm+f+++ds+err+sG+v+g+ d+dp++WpnS+Wr+L
  Gorai.006G120400.6 285 VANALSMKSMFHVFYSPRASHAEFVIPFRKYFKSIANSVCIGTRFKMRFDMDDSPERRFSGVVMGMGDSDPYKWPNSRWRCL 366
                         689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-41151272IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-44152276IPR015300DNA-binding pseudobarrel domain
CDDcd100178.12E-24157259No hitNo description
PfamPF023621.3E-22159260IPR003340B3 DNA binding domain
SMARTSM010197.2E-25159261IPR003340B3 DNA binding domain
PROSITE profilePS5086313.014159261IPR003340B3 DNA binding domain
PfamPF065073.2E-32285366IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MEIDLNHALS EVEKTAVCNG GCDKLNCVCS SSSSNLASPP CTSSIYLELW HACAGPLTSL  60
PKKGNLVVYF PQGHLEQLAS ASPFSPLEIS TFDLPPHIFC KVVNVQLLAN KENDEVYTQL  120
TLLPQPELRE PNLESKQLDE LGVDEGDDGS PKRSTPHMFC KTLTASDTST HGGFSVPRRA  180
AEDCFPPLDY KQTRPSQELV AKDLHGVEWR FRHIYRGQPR RHLLTTGWSI FVSQKNLVAG  240
DAVLFLRGED GELRLGIRRA VRPRNCLPES VIAKQNSYLN VLSPVANALS MKSMFHVFYS  300
PRASHAEFVI PFRKYFKSIA NSVCIGTRFK MRFDMDDSPE RRFSGVVMGM GDSDPYKWPN  360
SRWRCLMVRW DEDNMIDRHE RVSPWEIDPS ASLPPFSIQS SPRLKKLRTG GSRFLDFEEP  420
LRSSKVLQGQ ENVGFVSPLY GRDTVSRPLD FEMQSPAHHQ SLASTGIEKS NISEFMRVRS  480
TTYTGFADSN RFPKVLQGQE ICQLRSLTQK ADLNPGVWAK TNLGCNSFNM HQTLRTNCYP  540
LASEGLRNMY FPYGEFLKTV QEPTMSSYAC PLRRGNVPFN ASSIRTGVGV IVDGFRKPNQ  600
QNEHKPLENI PSPASENNLR NQQDDSFKRN VAGCKLFGFP LNVESPTPNS QNSGKRSCTK  660
VSLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1274838922354Auxin response factor 1
4ldw_A1e-1274838922354Auxin response factor 1
4ldw_B1e-1274838922354Auxin response factor 1
4ldy_A1e-1274838922354Auxin response factor 1
4ldy_B1e-1274838922354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485241.10.0PREDICTED: auxin response factor 4-like isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A0D2Q8C90.0A0A0D2Q8C9_G
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]